ADAR Antibody (CL0176)

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP3-05500 antibody. Corresponding ADAR RNA-seq data ...read more
Genetic Strategies: Western Blot: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: ADAR Antibody (CL0176) [NBP3-05500] - Staining of A549 cells using the Anti-ADAR monoclonal antibody, showing specific staining in the nucleoplasm and nucleoli in green. ...read more
Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human cerebral cortex shows nuclear positivity.
Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human testis shows nuclear positivity.
Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
CL0176
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADAR Antibody (CL0176) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ADAR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation permeabilization use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ADAR Antibody (CL0176)

  • ADAR
  • ADAR1
  • ADAR1DSH
  • adenosine deaminase, RNA-specific
  • DRADA
  • DRADAP136
  • DSRAD
  • DSRADadenosine deaminase acting on RNA 1-A
  • EC 3.5.4
  • EC 3.5.4.-
  • EC 3.5.4.37
  • G1P1
  • G1P1double-stranded RNA-specific adenosine deaminase
  • IFI4
  • IFI-4
  • IFI4dsRNA adenosine deaminase
  • interferon-induced protein 4
  • Interferon-inducible protein 4
  • K88DSRBP
  • p136
  • p136,136 kDa double-stranded RNA-binding protein

Background

ADAR encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAR Antibody (NBP3-05500) (0)

There are no publications for ADAR Antibody (NBP3-05500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAR Antibody (NBP3-05500) (0)

There are no reviews for ADAR Antibody (NBP3-05500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADAR Antibody (NBP3-05500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAR Antibody (CL0176) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAR