Adenosine A1R Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Adenosine A1R Antibody [NBP2-58443] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenosine A1R Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Specificity
Specificity of human Adenosine A1R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADORA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Adenosine A1R Recombinant Protein Antigen (NBP2-58443PEP)

Reactivity Notes

Mouse 89%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Adenosine A1R Antibody

  • Adenosine A1 R
  • adenosine A1 receptor
  • Adenosine A1R
  • ADORA 1
  • ADORA1
  • RDC7
  • RDC7adenosine receptor A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NLS689
Species: Hu, Mu, Po, Ca, Eq, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-41312
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-58443
Species: Hu
Applications: ICC/IF

Publications for Adenosine A1R Antibody (NBP2-58443) (0)

There are no publications for Adenosine A1R Antibody (NBP2-58443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosine A1R Antibody (NBP2-58443) (0)

There are no reviews for Adenosine A1R Antibody (NBP2-58443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Adenosine A1R Antibody (NBP2-58443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Adenosine A1R Products

Bioinformatics Tool for Adenosine A1R Antibody (NBP2-58443)

Discover related pathways, diseases and genes to Adenosine A1R Antibody (NBP2-58443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosine A1R Antibody (NBP2-58443)

Discover more about diseases related to Adenosine A1R Antibody (NBP2-58443).
 

Pathways for Adenosine A1R Antibody (NBP2-58443)

View related products by pathway.

PTMs for Adenosine A1R Antibody (NBP2-58443)

Learn more about PTMs related to Adenosine A1R Antibody (NBP2-58443).
 

Research Areas for Adenosine A1R Antibody (NBP2-58443)

Find related products by research area.

Blogs on Adenosine A1R

There are no specific blogs for Adenosine A1R, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenosine A1R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADORA1