ADAMTSL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAMTSL2 Antibody [NBP2-14798] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules .
Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human adrenal gland shows weak cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human tonsil shows strong cytoplasmic and membranous positivity in germinal and non germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTSL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: PWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACC
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTSL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ADAMTSL2 Protein (NBP2-14798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTSL2 Antibody

  • ADAMTSL2 ADAMTS-like 2
  • ADAMTSL2
  • GPHYSD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
MAB5270
Species: Hu
Applications: IP, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NBP1-84185
Species: Hu
Applications: IHC, IHC-P, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
H00170691-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
G-125-C
Species: Hu
Applications:
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP2-14798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for ADAMTSL2 Antibody (NBP2-14798) (0)

There are no publications for ADAMTSL2 Antibody (NBP2-14798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTSL2 Antibody (NBP2-14798) (0)

There are no reviews for ADAMTSL2 Antibody (NBP2-14798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTSL2 Antibody (NBP2-14798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTSL2 Products

Diseases for ADAMTSL2 Antibody (NBP2-14798)

Discover more about diseases related to ADAMTSL2 Antibody (NBP2-14798).
 

Pathways for ADAMTSL2 Antibody (NBP2-14798)

View related products by pathway.

PTMs for ADAMTSL2 Antibody (NBP2-14798)

Learn more about PTMs related to ADAMTSL2 Antibody (NBP2-14798).

Blogs on ADAMTSL2

There are no specific blogs for ADAMTSL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTSL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTSL2
Entrez
Uniprot