ADAMTSL2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAMTSL2 Antibody [NBP2-14798] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules .

Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human adrenal gland shows weak cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: ADAMTSL2 Antibody [NBP2-14798] - Staining of human tonsil shows strong cytoplasmic and membranous positivity in germinal and non germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAMTSL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADAMTSL2 Antibody - BSA Free (NBP2-14798) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACC
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTSL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  ADAMTSL2 Protein (NBP2-14798PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAMTSL2 Antibody - BSA Free

• ADAMTSL2 ADAMTS-like 2
• ADAMTSL2
• GPHYSD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTSL2
• Entrez:
  • 9719(Human)
• Uniprot:
  • Q86TH1(Human)