ADAMTS3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAMTS3 Antibody [NBP2-30775] - Staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: ADAMTS3 Antibody [NBP2-30775] - Staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAMTS3 Protein (NBP2-30775PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAMTS3 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 3
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3
  • ADAM metallopeptidase with thrombospondin type 1 motif, 3
  • ADAM-TS 3
  • ADAMTS3
  • ADAM-TS3
  • ADAMTS-3
  • ADAMTS-4
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.14
  • KIAA0366PC II-NP
  • PC II-NP
  • Procollagen II amino propeptide-processing enzyme
  • Procollagen II N-proteinase
  • zinc metalloendopeptidase

Background

The ADAMTS3 gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAMTS3 Antibody (NBP2-30775) (0)

There are no publications for ADAMTS3 Antibody (NBP2-30775).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS3 Antibody (NBP2-30775) (0)

There are no reviews for ADAMTS3 Antibody (NBP2-30775). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTS3 Antibody (NBP2-30775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS3
Uniprot