ADAMTS3 Antibody


Immunohistochemistry: ADAMTS3 Antibody [NBP2-30495] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ADAMTS3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAMTS3 Protein (NBP2-30495PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADAMTS3 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 3
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3
  • ADAM metallopeptidase with thrombospondin type 1 motif, 3
  • ADAM-TS 3
  • ADAM-TS3
  • ADAMTS-3
  • ADAMTS-4
  • EC 3.4.24
  • EC 3.4.24.-
  • EC
  • KIAA0366PC II-NP
  • PC II-NP
  • Procollagen II amino propeptide-processing enzyme
  • Procollagen II N-proteinase
  • zinc metalloendopeptidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADAMTS3 Antibody (NBP2-30495) (0)

There are no publications for ADAMTS3 Antibody (NBP2-30495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS3 Antibody (NBP2-30495) (0)

There are no reviews for ADAMTS3 Antibody (NBP2-30495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ADAMTS3 Antibody (NBP2-30495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAMTS3 Products

Bioinformatics Tool for ADAMTS3 Antibody (NBP2-30495)

Discover related pathways, diseases and genes to ADAMTS3 Antibody (NBP2-30495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS3 Antibody (NBP2-30495)

Discover more about diseases related to ADAMTS3 Antibody (NBP2-30495).

Pathways for ADAMTS3 Antibody (NBP2-30495)

View related products by pathway.

PTMs for ADAMTS3 Antibody (NBP2-30495)

Learn more about PTMs related to ADAMTS3 Antibody (NBP2-30495).

Blogs on ADAMTS3

There are no specific blogs for ADAMTS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAMTS3 Antibody and receive a gift card or discount.


Gene Symbol ADAMTS3