ADAMTS19 Antibody

Images

 
Western Blot: ADAMTS19 Antibody [NBP1-69170] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAMTS19 Antibody Summary

Immunogen
Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAMTS19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ADAMTS19 and was validated on Western blot.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAMTS19 Antibody

  • A disintegrin and metalloproteinase with thrombospondin motifs 19
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19
  • ADAM metallopeptidase with thrombospondin type 1 motif, 19
  • ADAM-TS 19
  • ADAM-TS19
  • ADAMTS-19
  • EC 3.4.24.-
  • FLJ16042

Background

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4245
Species: Hu
Applications: WB, IP
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81299
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
5096-BM
Species: Hu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS1436
Species: Hu
Applications: IHC-P
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NBP2-05595
Species: Hu
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP2-05605
Species: Hu
NBP1-69170
Species: Hu
Applications: WB

Publications for ADAMTS19 Antibody (NBP1-69170) (0)

There are no publications for ADAMTS19 Antibody (NBP1-69170).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS19 Antibody (NBP1-69170) (0)

There are no reviews for ADAMTS19 Antibody (NBP1-69170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMTS19 Antibody (NBP1-69170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAMTS19 Products

Bioinformatics Tool for ADAMTS19 Antibody (NBP1-69170)

Discover related pathways, diseases and genes to ADAMTS19 Antibody (NBP1-69170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS19 Antibody (NBP1-69170)

Discover more about diseases related to ADAMTS19 Antibody (NBP1-69170).
 

Pathways for ADAMTS19 Antibody (NBP1-69170)

View related products by pathway.

Blogs on ADAMTS19

There are no specific blogs for ADAMTS19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAMTS19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS19
Entrez
Uniprot