ADAMTS19 Antibody - BSA Free

Western Blot: ADAMTS19 Antibody [NBP1-69170] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAMTS19 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAMTS19 Antibody - BSA Free

• A disintegrin and metalloproteinase with thrombospondin motifs 19
• a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19
• ADAM metallopeptidase with thrombospondin type 1 motif, 19
• ADAM-TS 19
• ADAM-TS19
• ADAMTS-19
• EC 3.4.24.-
• FLJ16042

Background

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS19
• Entrez:
  • 171019(Human)
• Uniprot:
  • Q8TE59(Human)