ADAM28 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAM28 Antibody [NBP2-55995] - Staining of human cell line U-2 OS shows localization to plasma membrane and mitochondria.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining in human epididymis and liver tissues using anti-ADAM28 antibody. Corresponding ADAM28 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM28 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Specificity
Specificity of human ADAM28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM28
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAM28 Recombinant Protein Antigen (NBP2-55995PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAM28 Antibody

  • a disintegrin and metalloproteinase domain 28
  • ADAM metallopeptidase domain 28
  • ADAM23MDC-L
  • ADAM28
  • disintegrin and metalloproteinase domain-containing protein 28
  • Dtgn1
  • EC 3.4.24
  • EC 3.4.24.-
  • eMDC II
  • eMDCII
  • Epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich proteinII
  • MDCL
  • MDCLADAM 28
  • MDC-Lm
  • MDC-Ls
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L
  • metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L
  • Protein-L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB49081
Species: Hu
Applications: WB, IP
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
H00004185-M01
Species: Hu
Applications: WB, ELISA
930-ADB
Species: Hu
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
AF1031
Species: Hu
Applications: WB, IP, ICC
46780002
Species: Hu
Applications: ELISA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55995
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADAM28 Antibody (NBP2-55995) (0)

There are no publications for ADAM28 Antibody (NBP2-55995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM28 Antibody (NBP2-55995) (0)

There are no reviews for ADAM28 Antibody (NBP2-55995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAM28 Antibody (NBP2-55995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM28 Products

Bioinformatics Tool for ADAM28 Antibody (NBP2-55995)

Discover related pathways, diseases and genes to ADAM28 Antibody (NBP2-55995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM28 Antibody (NBP2-55995)

Discover more about diseases related to ADAM28 Antibody (NBP2-55995).
 

Pathways for ADAM28 Antibody (NBP2-55995)

View related products by pathway.

PTMs for ADAM28 Antibody (NBP2-55995)

Learn more about PTMs related to ADAM28 Antibody (NBP2-55995).

Blogs on ADAM28

There are no specific blogs for ADAM28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM28
Entrez