ADAM28 Antibody


Immunocytochemistry/ Immunofluorescence: ADAM28 Antibody [NBP2-55995] - Staining of human cell line U-2 OS shows localization to plasma membrane and mitochondria.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining in human epididymis and liver tissues using anti-ADAM28 antibody. Corresponding ADAM28 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-55995] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ADAM28 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Specificity of human ADAM28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAM28 Recombinant Protein Antigen (NBP2-55995PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ADAM28 Antibody

  • a disintegrin and metalloproteinase domain 28
  • ADAM metallopeptidase domain 28
  • ADAM28
  • disintegrin and metalloproteinase domain-containing protein 28
  • Dtgn1
  • EC 3.4.24
  • EC 3.4.24.-
  • eMDC II
  • eMDCII
  • Epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich proteinII
  • MDCL
  • MDC-Lm
  • MDC-Ls
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L
  • metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L
  • Protein-L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, IP, ICC
Species: Mu
Applications: WB
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ADAM28 Antibody (NBP2-55995) (0)

There are no publications for ADAM28 Antibody (NBP2-55995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM28 Antibody (NBP2-55995) (0)

There are no reviews for ADAM28 Antibody (NBP2-55995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAM28 Antibody (NBP2-55995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ADAM28 Antibody (NBP2-55995)

Discover related pathways, diseases and genes to ADAM28 Antibody (NBP2-55995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM28 Antibody (NBP2-55995)

Discover more about diseases related to ADAM28 Antibody (NBP2-55995).

Pathways for ADAM28 Antibody (NBP2-55995)

View related products by pathway.

PTMs for ADAM28 Antibody (NBP2-55995)

Learn more about PTMs related to ADAM28 Antibody (NBP2-55995).

Blogs on ADAM28

There are no specific blogs for ADAM28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAM28 Antibody and receive a gift card or discount.


Gene Symbol ADAM28