ADAM19 Antibody - BSA Free

Western Blot: ADAM19 Antibody [NBP1-69367] - This Anti-ADAM19 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAM19 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19. Peptide sequence GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Dendritic Cell Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAM19 Antibody - BSA Free

• a disintegrin and metalloproteinase domain 19 (meltrin beta)
• ADAM 19
• ADAM metallopeptidase domain 19
• ADAM19
• disintegrin and metalloproteinase domain-containing protein 19
• EC 3.4.24
• EC 3.4.24.-
• MADDAM
• Meltrin beta
• meltrin-beta
• Metalloprotease and disintegrin dendritic antigen marker
• MLTNBmeltrin beta

Background

ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADAM19 Antibody (NBP1-69367)(1)

Publication using NBP1-69367

• Aydin A, Klenk C, Nemec K et Al. ADAM19 cleaves the PTH receptor and associates with brachydactyly type E Life Sci Alliance 2024-02-08 [PMID: 38331475]

Bioinformatics

• Gene Symbol: ADAM19
• Uniprot:
  • Q9H013()