ACTR1B Antibody

Images

 
Western Blot: ACTR1B Antibody [NBP2-88761] - WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysateACTR1B is supported by BioGPS gene expression data to be ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR1B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACTR1B. Peptide sequence: VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTR1B Antibody

  • Actin-related protein 1B
  • ARP1 (actin-related protein 1, yeast) homolog B (centractin beta)
  • ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
  • ARP1BPC3
  • centractin beta
  • CTRN2beta-centractin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP2-38536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
DKK300
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DY262
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for ACTR1B Antibody (NBP2-88761) (0)

There are no publications for ACTR1B Antibody (NBP2-88761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR1B Antibody (NBP2-88761) (0)

There are no reviews for ACTR1B Antibody (NBP2-88761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTR1B Antibody (NBP2-88761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTR1B Products

Bioinformatics Tool for ACTR1B Antibody (NBP2-88761)

Discover related pathways, diseases and genes to ACTR1B Antibody (NBP2-88761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR1B Antibody (NBP2-88761)

Discover more about diseases related to ACTR1B Antibody (NBP2-88761).

Research Areas for ACTR1B Antibody (NBP2-88761)

Find related products by research area.

Blogs on ACTR1B

There are no specific blogs for ACTR1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR1B