ACOX3 Antibody - Azide and BSA Free

Western Blot: ACOX3 Antibody - Azide and BSA Free [NBP3-15513] - Western blot analysis of lysates from MCF7 cells using ACOX3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: ACOX3 Antibody [NBP3-15513] - Immunofluorescence analysis of C6 cells using ACOX3 antibody (NBP3-15513) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: ACOX3 Antibody [NBP3-15513] - Immunofluorescence analysis of U-2 OS cells using ACOX3 antibody (NBP3-15513) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ACOX3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ACOX3 Antibody - Azide and BSA Free (NBP3-15513) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137). TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACOX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ACOX3 Antibody - Azide and BSA Free

• acyl-CoA oxidase 3, pristanoyl
• Branched-chain acyl-CoA oxidase
• BRCACox
• BRCOX
• EC 1.3.3.6
• peroxisomal acyl-coenzyme A oxidase 3
• PRCOX
• pristanoyl
• Pristanoyl-CoA oxidase

Background

ACOX3, also known as Peroxisomal acyl-coenzyme A oxidase 3, consists of a 78 kDa and a shorter 70 kDa isoform, and is involved in the oxidation of 2-methyl-branched fatty acids in CoA-esters. Disease research is currently being conducted with ACOX3 and its relation to prostate cancer, prostatitis, and leukemia. This protein has been shown to have interactions with SMURF2, SLC2A4, ACAA1, ACAA2, and ACAT1 in the PPAR signaling pathway and a variety of metabolic pathways including those of peroxisomal lipids, lipoproteins, and fatty acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ACOX3