ACOX3 Antibody


Western Blot: ACOX3 Antibody [NBP1-74273] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ACOX3 Antibody Summary

Synthetic peptides corresponding to the C terminal of ACOX3. Immunizing peptide sequence SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACOX3 and was validated on Western blot.
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACOX3 Antibody

  • acyl-CoA oxidase 3, pristanoyl
  • Branched-chain acyl-CoA oxidase
  • BRCACox
  • EC
  • peroxisomal acyl-coenzyme A oxidase 3
  • pristanoyl
  • Pristanoyl-CoA oxidase


Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
Species: Hu(-), Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB

Publications for ACOX3 Antibody (NBP1-74273) (0)

There are no publications for ACOX3 Antibody (NBP1-74273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOX3 Antibody (NBP1-74273) (0)

There are no reviews for ACOX3 Antibody (NBP1-74273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOX3 Antibody (NBP1-74273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACOX3 Products

Array NBP1-74273

Bioinformatics Tool for ACOX3 Antibody (NBP1-74273)

Discover related pathways, diseases and genes to ACOX3 Antibody (NBP1-74273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX3 Antibody (NBP1-74273)

Discover more about diseases related to ACOX3 Antibody (NBP1-74273).

Pathways for ACOX3 Antibody (NBP1-74273)

View related products by pathway.

PTMs for ACOX3 Antibody (NBP1-74273)

Learn more about PTMs related to ACOX3 Antibody (NBP1-74273).

Research Areas for ACOX3 Antibody (NBP1-74273)

Find related products by research area.

Blogs on ACOX3

There are no specific blogs for ACOX3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACOX3 Antibody and receive a gift card or discount.


Gene Symbol ACOX3