ACAT2 Antibody

Images

 
Western Blot: ACAT2 Antibody [NBP1-89525] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: ACAT2 Antibody [NBP1-89525] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACAT2 Protein (NBP1-89525PEP)
Publications
Read Publication using
NBP1-89525 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24506864). Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAT2 Antibody

  • acetoacetyl Coenzyme A thiolase
  • acetyl-CoA acetyltransferase 2
  • acetyl-CoA acetyltransferase, cytosolic
  • Acetyl-CoA transferase-like protein
  • acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)
  • acetyl-Coenzyme A acetyltransferase 2
  • ACTL
  • Cytosolic acetoacetyl-CoA thiolase
  • EC 2.3.1
  • EC 2.3.1.9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45981
Species: Hu
Applications: IHC
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-71706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-527
Species: Hu, Mu
Applications: WB
NB400-128
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB9120
Species: Hu
Applications: ICC

Publications for ACAT2 Antibody (NBP1-89525)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ACAT2 Antibody (NBP1-89525) (0)

There are no reviews for ACAT2 Antibody (NBP1-89525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAT2 Antibody (NBP1-89525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAT2 Products

Bioinformatics Tool for ACAT2 Antibody (NBP1-89525)

Discover related pathways, diseases and genes to ACAT2 Antibody (NBP1-89525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAT2 Antibody (NBP1-89525)

Discover more about diseases related to ACAT2 Antibody (NBP1-89525).
 

Pathways for ACAT2 Antibody (NBP1-89525)

View related products by pathway.

PTMs for ACAT2 Antibody (NBP1-89525)

Learn more about PTMs related to ACAT2 Antibody (NBP1-89525).
 

Research Areas for ACAT2 Antibody (NBP1-89525)

Find related products by research area.

Blogs on ACAT2

There are no specific blogs for ACAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAT2
Entrez
Uniprot