ACADVL Antibody

Images

 
Western Blot: ACADVL Antibody [NBP1-89287] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: ACADVL Antibody [NBP1-89287] - Immunofluorescent staining of human cell line A549 shows localization to nucleus, nucleoli & mitochondria.
Immunohistochemistry-Paraffin: ACADVL Antibody [NBP1-89287] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Western Blot: ACADVL Antibody [NBP1-89287] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACADVL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADVL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACADVL Recombinant Protein Antigen (NBP1-89287PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADVL Antibody

  • ACAD6
  • acyl-CoA dehydrogenase, very long chain
  • acyl-Coenzyme A dehydrogenase, very long chain
  • EC 1.3.99
  • EC 1.3.99.-
  • LCACD
  • very long-chain specific acyl-CoA dehydrogenase, mitochondrial
  • VLCAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001376-B01P
Species: Hu
Applications: WB
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3998
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP1-89287
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACADVL Antibody (NBP1-89287) (0)

There are no publications for ACADVL Antibody (NBP1-89287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADVL Antibody (NBP1-89287) (0)

There are no reviews for ACADVL Antibody (NBP1-89287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACADVL Antibody (NBP1-89287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADVL Products

Bioinformatics Tool for ACADVL Antibody (NBP1-89287)

Discover related pathways, diseases and genes to ACADVL Antibody (NBP1-89287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADVL Antibody (NBP1-89287)

Discover more about diseases related to ACADVL Antibody (NBP1-89287).
 

Pathways for ACADVL Antibody (NBP1-89287)

View related products by pathway.

PTMs for ACADVL Antibody (NBP1-89287)

Learn more about PTMs related to ACADVL Antibody (NBP1-89287).

Blogs on ACADVL

There are no specific blogs for ACADVL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADVL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADVL