Novus Biologicals products are now on bio-techne.com

ACADM Antibody

Images

 
Immunohistochemistry: ACADM Antibody [NBP1-89293] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining in human kidney and skin tissues using anti-ACADM antibody. Corresponding ACADM RNA-seq data are presented for the same ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Analysis in human kidney and skin tissues. Corresponding ACADM RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human kidney, liver, lymph node and skin using Anti-ACADM antibody NBP1-89293 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human liver shows strong to very strong positivity in cytoplasm granular in hepatocytes.
Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACADM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIA
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACADM Protein (NBP1-89293PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADM Antibody

  • ACAD1
  • acyl-CoA dehydrogenase, C-4 to C-12 straight chain
  • acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
  • EC 1.3.99
  • EC 1.3.99.3
  • FLJ18227
  • FLJ99884
  • MCADFLJ93013
  • MCADH
  • medium-chain specific acyl-CoA dehydrogenase, mitochondrial

Background

ACADM protein is a medium chain specific (C4 to C12 straight chain) acyl Coenzyme A dehydrogenase. The enzyme catalyzes the initial step of the mitochondrial fatty acid beta oxidation pathway. ACADM expression is induced during periods of fasting, when reliance on fatty acids for energy is increased. Clinical phenotypes are associated with ACADM hereditary deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-15238
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP1-89289
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-44421
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP1-47254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-03047
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008463-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
H00113246-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB

Publications for ACADM Antibody (NBP1-89293) (0)

There are no publications for ACADM Antibody (NBP1-89293).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADM Antibody (NBP1-89293) (0)

There are no reviews for ACADM Antibody (NBP1-89293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACADM Antibody (NBP1-89293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACADM Products

Research Areas for ACADM Antibody (NBP1-89293)

Find related products by research area.

Blogs on ACADM

There are no specific blogs for ACADM, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADM