ACADM Antibody - BSA Free

Immunohistochemistry: ACADM Antibody [NBP1-89293] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human skin shows low expression as expected.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining in human kidney and skin tissues using anti-ACADM antibody. Corresponding ACADM RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Analysis in human kidney and skin tissues. Corresponding ACADM RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human kidney, liver, lymph node and skin using Anti-ACADM antibody NBP1-89293 (A) shows similar protein distribution across tissues to independent antibody NBP1-89292 (B).

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human liver shows strong to very strong positivity in cytoplasm granular in hepatocytes.

Immunohistochemistry-Paraffin: ACADM Antibody [NBP1-89293] - Staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACADM Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIA
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACADM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACADM Protein (NBP1-89293PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACADM Antibody - BSA Free

• ACAD1
• acyl-CoA dehydrogenase, C-4 to C-12 straight chain
• acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
• EC 1.3.99
• EC 1.3.99.3
• FLJ18227
• FLJ99884
• MCADFLJ93013
• MCADH
• medium-chain specific acyl-CoA dehydrogenase, mitochondrial

Background

ACADM protein is a medium chain specific (C4 to C12 straight chain) acyl Coenzyme A dehydrogenase. The enzyme catalyzes the initial step of the mitochondrial fatty acid beta oxidation pathway. ACADM expression is induced during periods of fasting, when reliance on fatty acids for energy is increased. Clinical phenotypes are associated with ACADM hereditary deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACADM