ACAA1 Antibody - BSA Free

Western Blot: ACAA1 Antibody [NBP1-86128] - Analysis using Anti-ACAA1 antibody NBP1-86128 (A) shows similar pattern to independent antibody NBP1-85786 (B).

Immunocytochemistry/Immunofluorescence: ACAA1 Antibody [NBP1-86128] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Analysis in human liver and skin tissues using HPA006764 antibody. Corresponding ACAA1 RNA-seq data are presented for the same tissues.

Staining of human skin shows very weak positivity in squamous epithelial cells.

Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.

Staining of human kidney shows strong granular cytoplasmic positivity in proximal tubules.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACAA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACAA1 Antibody - BSA Free (NBP1-86128) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA
• Marker: Peroxisome Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACAA1 Protein (NBP1-86128PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACAA1 Antibody - BSA Free

• acetyl-CoA acyltransferase 1
• Acetyl-CoA acyltransferase
• EC 2.3.1
• peroxisomal

Background

Acetyl-Coenzyme A acyltransferase (ACAA1) is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAA1