ABL2 Antibody (6D5)

Images

 
Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M03), clone 6D5. Lane 1: ABL2 transfected lysatE (126.7 KDa). Lane 2: ...read more
Genetic Strategies: Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 over-expressed 293 cell line. Lane 2 cotransfected with ABL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot ...read more
Western Blot: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of ABL2 expression in Hela S3 NE (Cat # L013V3).
ELISA: ABL2 Antibody (6D5) [H00000027-M03] - Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: ABL2 Antibody (6D5) [H00000027-M03] - Analysis of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-ABL2 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, RNAi, S-ELISA
Clone
6D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ABL2 Antibody (6D5) Summary

Immunogen
ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Specificity
ABL2 (6D5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Proximity Ligation Assay
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Control
ABL2 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABL2 Antibody (6D5)

  • Abelson murine leukemia viral (v-abl) oncogene homolog 2
  • Abelson murine leukemia viral oncogene homolog 2
  • Abelson-related gene protein
  • Abelson-relatedgene)
  • arg tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ22224
  • FLJ31718
  • FLJ41441
  • tyrosine-protein kinase ABL2
  • Tyrosine-protein kinase ARG
  • v-abl Abelson murine leukemia viral oncogene homolog 2

Background

The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68008
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF5414
Species: Hu
Applications: WB, Simple Western
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP1-62489
Species: Hu, Mu, Dr
Applications: WB
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready

Publications for ABL2 Antibody (H00000027-M03) (0)

There are no publications for ABL2 Antibody (H00000027-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABL2 Antibody (H00000027-M03) (0)

There are no reviews for ABL2 Antibody (H00000027-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABL2 Antibody (H00000027-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABL2 Products

Bioinformatics Tool for ABL2 Antibody (H00000027-M03)

Discover related pathways, diseases and genes to ABL2 Antibody (H00000027-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABL2 Antibody (H00000027-M03)

Discover more about diseases related to ABL2 Antibody (H00000027-M03).
 

Pathways for ABL2 Antibody (H00000027-M03)

View related products by pathway.

PTMs for ABL2 Antibody (H00000027-M03)

Learn more about PTMs related to ABL2 Antibody (H00000027-M03).
 

Research Areas for ABL2 Antibody (H00000027-M03)

Find related products by research area.

Blogs on ABL2

There are no specific blogs for ABL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABL2 Antibody (6D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABL2
Entrez
OMIM
Uniprot