ABCG8 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ABCG8 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCG8.
  
  

  Source: E. coli

  Amino Acid Sequence: HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ABCG8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83388.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCG8 Recombinant Protein Antigen

• ATP-binding cassette sub-family G member 8
• ATP-binding cassette, sub-family G (WHITE), member 8 (sterolin 2)
• ATP-binding cassette, sub-family G (WHITE), member 8
• GBD4ATP-binding cassette, subfamily G, member 8
• MGC142217
• sterolin 2
• sterolin-2
• STSL

Background

ATP-binding cassette sub-family G member 8 (ABCG8) is a member of the superfamily of ATP-binding cassette transporters and a member of the White subfamily.

Transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. Specifically, ABCG8 is responsible for the selective transport of dietary cholesterol in/out of the enterocytes and in the selective liver sterol excretion into bile. ABCG8 also cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols.

ABCG8 is highly expressed in the liver and intestine. Mutated forms of ABCG8 lead to sterol accumulation and can cause atherosclerosis or sitosterolemia, a rare autosomal recessive disorder characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.

ABCG8 antibodies are useful tools for cholesterol absorbtion/sectretion studies and are fundamental to the understanding of certian liver functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ABCG8