ABCG8 Recombinant Protein Antigen

Images

 
There are currently no images for ABCG8 Protein (NBP1-83388PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCG8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCG8.

Source: E. coli

Amino Acid Sequence: HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCG8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83388.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCG8 Recombinant Protein Antigen

  • ATP-binding cassette sub-family G member 8
  • ATP-binding cassette, sub-family G (WHITE), member 8 (sterolin 2)
  • ATP-binding cassette, sub-family G (WHITE), member 8
  • GBD4ATP-binding cassette, subfamily G, member 8
  • MGC142217
  • sterolin 2
  • sterolin-2
  • STSL

Background

ATP-binding cassette sub-family G member 8 (ABCG8) is a member of the superfamily of ATP-binding cassette transporters and a member of the White subfamily.

Transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. Specifically, ABCG8 is responsible for the selective transport of dietary cholesterol in/out of the enterocytes and in the selective liver sterol excretion into bile. ABCG8 also cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols.

ABCG8 is highly expressed in the liver and intestine. Mutated forms of ABCG8 lead to sterol accumulation and can cause atherosclerosis or sitosterolemia, a rare autosomal recessive disorder characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.

ABCG8 antibodies are useful tools for cholesterol absorbtion/sectretion studies and are fundamental to the understanding of certian liver functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80712
Species: Hu
Applications: ICC/IF
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB400-128
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-30876
Species: Hu
Applications: IHC,  IHC-P
NBP1-89319
Species: Hu
Applications: IHC,  IHC-P
MAB9120
Species: Hu
Applications: ICC
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, In vitro, In vivo, Simple Western, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
AF3664
Species: Hu
Applications: Simple Western, WB
NBP2-61616
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-69023
Species: Mu
Applications: WB
NBP2-45981
Species: Hu
Applications: IHC,  IHC-P
NB100-74543
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for ABCG8 Protein (NBP1-83388PEP) (0)

There are no publications for ABCG8 Protein (NBP1-83388PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCG8 Protein (NBP1-83388PEP) (0)

There are no reviews for ABCG8 Protein (NBP1-83388PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCG8 Protein (NBP1-83388PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCG8 Products

Research Areas for ABCG8 Protein (NBP1-83388PEP)

Find related products by research area.

Blogs on ABCG8.

Understanding Sitosterolemia: How ABCG5-ABCG8 Dimer Affects Blood Sterol Levels
The ATP binding cassette (ABC) transporter family is the largest and most diverse family of membrane transport proteins and, as the name suggests, uses the energy generated by ATP hydrolysis to transport substrates across membranes. Eukaryotic ABC tra...  Read full blog post.

ABCG2: A Tumor Protector
ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters...  Read full blog post.

Exploring how ABCG8 Affects Heart Disease
The high prevalence of atherosclerosis in developed nations is not breaking news; it has been well established that heart disease is the leading cause of death in the United States, and it presents a major socioeconomic burden. Investigators across th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCG8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG8