ABCF2 Antibody


Western Blot: ABCF2 Antibody [NBP1-89316] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ABCF2 Antibody [NBP1-89316] - Staining of human stomach shows moderate positivity in chief cells.
Western Blot: ABCF2 Antibody [NBP1-89316] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ABCF2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:CVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABCF2 Protein (NBP1-89316PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ABCF2 Antibody

  • ABC28
  • ABC-type transport protein
  • ATP-binding cassette sub-family F member 2
  • ATP-binding cassette, sub-family F (GCN20), member 2
  • DKFZp586K1823
  • EC 3.6.3
  • EC
  • EST133090
  • HUSSY18
  • HUSSY-18
  • Iron inhibited ABC transporter 2
  • Iron-inhibited ABC transporter 2
  • M-ABC1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS

Publications for ABCF2 Antibody (NBP1-89316) (0)

There are no publications for ABCF2 Antibody (NBP1-89316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCF2 Antibody (NBP1-89316) (0)

There are no reviews for ABCF2 Antibody (NBP1-89316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCF2 Antibody (NBP1-89316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABCF2 Products

Bioinformatics Tool for ABCF2 Antibody (NBP1-89316)

Discover related pathways, diseases and genes to ABCF2 Antibody (NBP1-89316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCF2 Antibody (NBP1-89316)

Discover more about diseases related to ABCF2 Antibody (NBP1-89316).

Pathways for ABCF2 Antibody (NBP1-89316)

View related products by pathway.

PTMs for ABCF2 Antibody (NBP1-89316)

Learn more about PTMs related to ABCF2 Antibody (NBP1-89316).

Research Areas for ABCF2 Antibody (NBP1-89316)

Find related products by research area.

Blogs on ABCF2.

Cancer studies with ABCF2
ATP-binding cassette superfamily F2 (ABCF2) is a member of the ATP-binding cassette (ABC) transporter superfamily, and more specifically, a member of the GCN20 subfamily. Most members of this family are membrane proteins that transport various substra...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCF2 Antibody and receive a gift card or discount.


Gene Symbol ABCF2