ABCF1 Antibody (1B4)

Images

 
Immunocytochemistry/ Immunofluorescence: ABCF1 Antibody (1B4) [H00000023-M01] - Analysis of monoclonal antibody to ABCF1 on HeLa cell . Antibody concentration 10 ug/ml.
ELISA: ABCF1 Antibody (1B4) [H00000023-M01] - Detection limit for recombinant GST tagged ABCF1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
1B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ABCF1 Antibody (1B4) Summary

Immunogen
ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Specificity
ABCF1 - ATP-binding cassette, sub-family F (GCN20), member 1 (1B4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABCF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ABCF1 Antibody (1B4)

  • ABC27
  • ABC50TNFalpha-inducible ATP-binding protein
  • ATP-binding cassette 50 (TNF-alpha stimulated)
  • ATP-binding cassette 50
  • ATP-binding cassette sub-family F member 1
  • ATP-binding cassette, sub-family F (GCN20), member 1
  • EC 2.7.7.6
  • EC 3.6.3.17
  • EST123147
  • TNF-alpha-stimulated ABC protein

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
H00089845-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NB400-116
Species: Hu, Pm
Applications: ICC/IF, IP, WB
NBP1-20863
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
NB400-115
Species: Hu, Mu, Ye
Applications: ICC/IF, KD, Simple Western, WB
NB400-163
Species: Mu
Applications: Flow, IHC, IHC-P, WB
NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-84781
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009533-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000023-M01
Species: Hu
Applications: ELISA, ICC/IF

Publications for ABCF1 Antibody (H00000023-M01) (0)

There are no publications for ABCF1 Antibody (H00000023-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCF1 Antibody (H00000023-M01) (0)

There are no reviews for ABCF1 Antibody (H00000023-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCF1 Antibody (H00000023-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCF1 Products

Bioinformatics Tool for ABCF1 Antibody (H00000023-M01)

Discover related pathways, diseases and genes to ABCF1 Antibody (H00000023-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCF1 Antibody (H00000023-M01)

Discover more about diseases related to ABCF1 Antibody (H00000023-M01).
 

Pathways for ABCF1 Antibody (H00000023-M01)

View related products by pathway.

PTMs for ABCF1 Antibody (H00000023-M01)

Learn more about PTMs related to ABCF1 Antibody (H00000023-M01).
 

Research Areas for ABCF1 Antibody (H00000023-M01)

Find related products by research area.

Blogs on ABCF1

There are no specific blogs for ABCF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCF1 Antibody (1B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCF1
Entrez
Uniprot