ABCC9 Antibody (S319A-14) [Alexa Fluor® 647]

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clone: S319A-14
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Alexa Fluor 647

ABCC9 Antibody (S319A-14) [Alexa Fluor® 647] Summary

• Description: This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
  
  For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
• Localization: Membrane
• Specificity: Detects approx 120kDa. Does not cross-react with SUR2B.
• Isotype: IgG2a
• Clonality: Monoclonal
• Host: Mouse
• Gene: ABCC9
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
• Application Notes: Recommended applications are based on validated applications from the unconjugated base product NBP2-22403. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein G purified

Alternate Names for ABCC9 Antibody (S319A-14) [Alexa Fluor® 647]

• ABC37
• ABCC9
• ATP-binding cassette, sub-family C (CFTR/MRP), member 9
• CMD1OATP-binding cassette transporter sub-family C member 9
• EC 3.6.3.44
• FLJ36852
• Sulfonylurea receptor 2
• sulfonylurea receptor 2A
• SUR2
• SUR2ATP-binding cassette sub-family C member 9

Background

The protein encoded by the ABCC9 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCC9