We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ABCC9 Antibody (S319A-14) [Alexa Fluor® 532]

Images

 
There are currently no images for ABCC9 Antibody (NBP2-22403AF532).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
S319A-14
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 532

Order Details

ABCC9 Antibody (S319A-14) [Alexa Fluor® 532] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Localization
Membrane
Specificity
Detects approx 120kDa. Does not cross-react with SUR2B.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
ABCC9
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP2-22403. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ABCC9 Antibody (S319A-14) [Alexa Fluor® 532]

  • ABC37
  • ABCC9
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 9
  • CMD1OATP-binding cassette transporter sub-family C member 9
  • EC 3.6.3.44
  • FLJ36852
  • Sulfonylurea receptor 2
  • sulfonylurea receptor 2A
  • SUR2
  • SUR2ATP-binding cassette sub-family C member 9

Background

The protein encoded by the ABCC9 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59324
Species: Ma, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-82874
Species: Hu
Applications: IHC,  IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
NBP2-46467
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-42349
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-556
Species: Hu
Applications: IP, WB
NBP2-22403AF532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ABCC9 Antibody (NBP2-22403AF532) (0)

There are no publications for ABCC9 Antibody (NBP2-22403AF532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC9 Antibody (NBP2-22403AF532) (0)

There are no reviews for ABCC9 Antibody (NBP2-22403AF532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCC9 Antibody (NBP2-22403AF532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCC9 Products

Array NBP2-22403AF532

Research Areas for ABCC9 Antibody (NBP2-22403AF532)

Find related products by research area.

Blogs on ABCC9

There are no specific blogs for ABCC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCC9 Antibody (S319A-14) [Alexa Fluor® 532] and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC9