ABCC9 Antibody (S319A-14) [DyLight 680]

Images

 
There are currently no images for ABCC9 Antibody (NBP2-22403FR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
S319A-14
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 680

ABCC9 Antibody (S319A-14) [DyLight 680] Summary

Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Localization
Membrane
Specificity
Detects approx 120kDa. Does not cross-react with SUR2B.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
ABCC9
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Based on homology, It's predicted to detect Rat.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes



0

Alternate Names for ABCC9 Antibody (S319A-14) [DyLight 680]

  • ABC37
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 9
  • CMD1OATP-binding cassette transporter sub-family C member 9
  • EC 3.6.3.44
  • FLJ36852
  • Sulfonylurea receptor 2
  • sulfonylurea receptor 2A
  • SUR2ATP-binding cassette sub-family C member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87710
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-22403FR
Species: Mu
Applications: WB, ICC/IF, IHC

Publications for ABCC9 Antibody (NBP2-22403FR) (0)

There are no publications for ABCC9 Antibody (NBP2-22403FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCC9 Antibody (NBP2-22403FR) (0)

There are no reviews for ABCC9 Antibody (NBP2-22403FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCC9 Antibody (NBP2-22403FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCC9 Products

Bioinformatics Tool for ABCC9 Antibody (NBP2-22403FR)

Discover related pathways, diseases and genes to ABCC9 Antibody (NBP2-22403FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCC9 Antibody (NBP2-22403FR)

Discover more about diseases related to ABCC9 Antibody (NBP2-22403FR).
 

Pathways for ABCC9 Antibody (NBP2-22403FR)

View related products by pathway.

PTMs for ABCC9 Antibody (NBP2-22403FR)

Learn more about PTMs related to ABCC9 Antibody (NBP2-22403FR).

Blogs on ABCC9

There are no specific blogs for ABCC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCC9 RNAi
H00010060-R06-20nmol
MDMX Antibody
NB100-556
MDMX Antibody
NB100-556
MDMX Antibody
NB100-556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCC9 Antibody (S319A-14) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC9