ABCB8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ABCB8 Antibody [NBP1-91643] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & mitochondria.

Immunohistochemistry-Paraffin: ABCB8 Antibody [NBP1-91643] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: ABCB8 Antibody [NBP1-91643] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and in a subset of glandular cells.

Immunohistochemistry-Paraffin: ABCB8 Antibody [NBP1-91643] - Staining of human skeletal muscle shows strong nuclear membrane and weak cytoplasmic staining in myocytes.

Immunohistochemistry-Paraffin: ABCB8 Antibody [NBP1-91643] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABCB8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABCB8 Antibody - BSA Free (NBP1-91643) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ABCB8 Protein (NBP1-91643PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABCB8 Antibody - BSA Free

• ATP-binding cassette, sub-family B (MDR/TAP), member 8
• EC 3.6.3
• EST328128
• M-ABC1mitochondrial ABC protein
• Mitochondrial ATP-binding cassette 1
• mitochondrial

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, it may involve the compartmentalization and transport of heme, as well as peptides, from the mitochondria to the nucleus and cytosol. This protein may also play a role in the transport of phospholipids into mitochondrial membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ABCB8 Antibody (NBP1-91643). (Showing 1 - 1 of 1 FAQ).

1. What is the concentration of this antibody?
   • The concentration of lot R41487 is 0.2mg/mL.

Bioinformatics

• Gene Symbol: ABCB8
• Entrez:
  • 11194(Human)
• Uniprot:
  • Q9NUT2(Human)