ABCA6 Antibody


Immunocytochemistry/ Immunofluorescence: ABCA6 Antibody [NBP2-57372] - Staining of human cell line RT4 shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ABCA6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYFDKILPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYF
Specificity of human ABCA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCA6 Recombinant Protein Antigen (NBP2-57372PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ABCA6 Antibody

  • ABC transporter ABCA6
  • ATP-binding cassette A6
  • ATP-binding cassette sub-family A member 6
  • ATP-binding cassette, sub-family A (ABC1), member 6
  • EC
  • EC 3.6.3
  • EC
  • EST155051
  • FLJ43498


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P

Publications for ABCA6 Antibody (NBP2-57372) (0)

There are no publications for ABCA6 Antibody (NBP2-57372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA6 Antibody (NBP2-57372) (0)

There are no reviews for ABCA6 Antibody (NBP2-57372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCA6 Antibody (NBP2-57372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCA6 Antibody and receive a gift card or discount.


Gene Symbol ABCA6