ABCA5 Antibody


Western Blot: ABCA5 Antibody [NBP1-59809] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.
Immunohistochemistry-Paraffin: ABCA5 Antibody [NBP1-59809] - Human Colon Tissue, antibody concentration 5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ABCA5 Antibody Summary

Synthetic peptides corresponding to ABCA5(ATP-binding cassette, sub-family A (ABC1), member 5) The peptide sequence was selected from the C terminal of ABCA5. Peptide sequence HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ABCA5 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCA5 Antibody

  • ABC13
  • ATP-binding cassette A5
  • ATP-binding cassette sub-family A member 5
  • ATP-binding cassette, sub-family A (ABC1), member 5
  • DKFZp451F117
  • DKFZp779N2435
  • EC 3.6.3
  • EC
  • EC
  • EST90625
  • FLJ16381
  • KIAA1888


The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, PCR
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ABCA5 Antibody (NBP1-59809) (0)

There are no publications for ABCA5 Antibody (NBP1-59809).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA5 Antibody (NBP1-59809) (0)

There are no reviews for ABCA5 Antibody (NBP1-59809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCA5 Antibody (NBP1-59809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ABCA5 Products

Array NBP1-59809

Bioinformatics Tool for ABCA5 Antibody (NBP1-59809)

Discover related pathways, diseases and genes to ABCA5 Antibody (NBP1-59809). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA5 Antibody (NBP1-59809)

Discover more about diseases related to ABCA5 Antibody (NBP1-59809).

Pathways for ABCA5 Antibody (NBP1-59809)

View related products by pathway.

Research Areas for ABCA5 Antibody (NBP1-59809)

Find related products by research area.

Blogs on ABCA5

There are no specific blogs for ABCA5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCA5 Antibody and receive a gift card or discount.


Gene Symbol ABCA5
Novus 100% Guarantee