ABAT Antibody

Images

 
Western Blot: ABAT Antibody [NBP1-83401] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: ABAT Antibody [NBP1-83401] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ABAT Protein (NBP1-83401PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABAT Antibody

  • (S)-3-amino-2-methylpropionate transaminase
  • 4-aminobutyrate aminotransferase
  • 4-aminobutyrate aminotransferase, mitochondrial
  • 4-aminobutyrate transaminase
  • EC 2.6.1.19
  • EC 2.6.1.22
  • FLJ17813
  • FLJ30272
  • G
  • GABA aminotransferase
  • GABA transaminase
  • GABA transferase
  • GABA-AT
  • GABA-T
  • GABATNPD009
  • Gamma-amino-N-butyrate transaminase
  • hCG1984265
  • L-AIBAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-86996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-83401
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ABAT Antibody (NBP1-83401) (0)

There are no publications for ABAT Antibody (NBP1-83401).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABAT Antibody (NBP1-83401) (0)

There are no reviews for ABAT Antibody (NBP1-83401). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABAT Antibody (NBP1-83401) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABAT Products

Bioinformatics Tool for ABAT Antibody (NBP1-83401)

Discover related pathways, diseases and genes to ABAT Antibody (NBP1-83401). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABAT Antibody (NBP1-83401)

Discover more about diseases related to ABAT Antibody (NBP1-83401).
 

Pathways for ABAT Antibody (NBP1-83401)

View related products by pathway.

PTMs for ABAT Antibody (NBP1-83401)

Learn more about PTMs related to ABAT Antibody (NBP1-83401).

Blogs on ABAT

There are no specific blogs for ABAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABAT
Entrez
Uniprot