AATK/Serine/threonine-protein kinase LMTK1 Antibody

Images

 
AATK/Serine/threonine-protein kinase LMTK1 Antibody [NBP1-90292] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AATK/Serine/threonine-protein kinase LMTK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AATK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AATK/Serine/threonine-protein kinase LMTK1 Protein (NBP1-90292PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AATK/Serine/threonine-protein kinase LMTK1 Antibody

  • AATK
  • AATYK
  • AATYKp35-binding protein
  • apoptosis-associated tyrosine kinaseCDK5-binding protein
  • Brain apoptosis-associated tyrosine kinase
  • EC 2.7.11
  • KIAA0641p35BP
  • Lemur tyrosine kinase 1
  • LMR1
  • LMR1EC 2.7.11.1
  • LMTK1
  • LMTK1AATYK1
  • p35BP
  • serine/threonine-protein kinase LMTK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89320
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8528
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-90292
Species: Hu
Applications: IHC, IHC-P

Publications for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292) (0)

There are no publications for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292) (0)

There are no reviews for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AATK/Serine/threonine-protein kinase LMTK1 Products

Bioinformatics Tool for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292)

Discover related pathways, diseases and genes to AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292)

Discover more about diseases related to AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292).
 

Pathways for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292)

View related products by pathway.

PTMs for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292)

Learn more about PTMs related to AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292).
 

Research Areas for AATK/Serine/threonine-protein kinase LMTK1 Antibody (NBP1-90292)

Find related products by research area.

Blogs on AATK/Serine/threonine-protein kinase LMTK1

There are no specific blogs for AATK/Serine/threonine-protein kinase LMTK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AATK/Serine/threonine-protein kinase LMTK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AATK
Entrez