AATF Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKG |
| Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AATF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AATF Antibody - BSA Free
Background
AATF is encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Publications for AATF Antibody (NBP3-17680) (0)
There are no publications for AATF Antibody (NBP3-17680).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AATF Antibody (NBP3-17680) (0)
There are no reviews for AATF Antibody (NBP3-17680).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AATF Antibody (NBP3-17680) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AATF Products
Research Areas for AATF Antibody (NBP3-17680)
Find related products by research area.
|
Blogs on AATF