Recombinant Human AAMP Protein

Images

 
SDS-Page: Recombinant Human AAMP Protein [H00000014-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AAMP Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human AAMP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AAMP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AAMP Protein

  • angio-associated migratory cell protein
  • angio-associated, migratory cell protein

Background

The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56152
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready

Publications for AAMP Partial Recombinant Protein (H00000014-Q01) (0)

There are no publications for AAMP Partial Recombinant Protein (H00000014-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAMP Partial Recombinant Protein (H00000014-Q01) (0)

There are no reviews for AAMP Partial Recombinant Protein (H00000014-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AAMP Partial Recombinant Protein (H00000014-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AAMP Products

Bioinformatics Tool for AAMP Partial Recombinant Protein (H00000014-Q01)

Discover related pathways, diseases and genes to AAMP Partial Recombinant Protein (H00000014-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAMP Partial Recombinant Protein (H00000014-Q01)

Discover more about diseases related to AAMP Partial Recombinant Protein (H00000014-Q01).
 

Pathways for AAMP Partial Recombinant Protein (H00000014-Q01)

View related products by pathway.

PTMs for AAMP Partial Recombinant Protein (H00000014-Q01)

Learn more about PTMs related to AAMP Partial Recombinant Protein (H00000014-Q01).

Blogs on AAMP

There are no specific blogs for AAMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AAMP Antibody
24430002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AAMP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AAMP