AADACL1 Antibody

Images

 
Western Blot: AADACL1 Antibody [NBP1-79318] - Mouse Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AADACL1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human Aadacl1The immunogen for this antibody is Aadacl1. Peptide sequence LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCEH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Aadacl1 and was validated on Western blot.
Publications
Read Publication using
NBP1-79318 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Human reported in scientific literature (PMID:32243091).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AADACL1 Antibody

  • AADACL1
  • EC 3.1.1.-
  • EC 3.1.1.71
  • EC 3.1.1.79
  • KIAA1363
  • KIAA1363EC 3.1.1
  • NCEH
  • NCEH1
  • NCEHArylacetamide deacetylase-like 1EC 3.1.1.-
  • neutral cholesterol ester hydrolase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-85691
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-02948
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-72386
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00000013-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NBP2-67909
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-85196
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-79318
Species: Hu, Mu
Applications: WB

Publications for AADACL1 Antibody (NBP1-79318)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for AADACL1 Antibody (NBP1-79318) (0)

There are no reviews for AADACL1 Antibody (NBP1-79318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AADACL1 Antibody (NBP1-79318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AADACL1 Products

Bioinformatics Tool for AADACL1 Antibody (NBP1-79318)

Discover related pathways, diseases and genes to AADACL1 Antibody (NBP1-79318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AADACL1 Antibody (NBP1-79318)

Discover more about diseases related to AADACL1 Antibody (NBP1-79318).
 

Pathways for AADACL1 Antibody (NBP1-79318)

View related products by pathway.

PTMs for AADACL1 Antibody (NBP1-79318)

Learn more about PTMs related to AADACL1 Antibody (NBP1-79318).
 

Research Areas for AADACL1 Antibody (NBP1-79318)

Find related products by research area.

Blogs on AADACL1

There are no specific blogs for AADACL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AADACL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCEH1
Uniprot