5-Lipoxygenase Antibody (5C5Z2)

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Raji cells, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Immunohistochemistry of paraffin-embedded mouse spleen using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Western blot analysis of extracts of Rat lung, using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Immunohistochemistry of paraffin-embedded human appendix using 5-Lipoxygenase Rabbit mAb (NBP3-16150) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: 5-Lipoxygenase Antibody (5C5Z2) [NBP3-16150] - Confocal imaging of U-2 OS cells using 5-Lipoxygenase Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5C5Z2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

5-Lipoxygenase Antibody (5C5Z2) Summary

• Description: Novus Biologicals Rabbit 5-Lipoxygenase Antibody (5C5Z2) (NBP3-16150) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 5-Lipoxygenase (P09917). CYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ALOX5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:100 - 1:1000
  • Immunohistochemistry-Paraffin 1:100 - 1:1000
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 5-Lipoxygenase Antibody (5C5Z2)

• 5Lipoxygenase
• 5-Lipoxygenase
• 5-LO
• 5-LOX
• 5LPG
• ALOX5
• arachidonate 5-lipoxygenase
• arachidonic 5-lipoxygenase alpha-10 isoform
• arachidonic 5-lipoxygenase delta-10-13 isoform
• arachidonic 5-lipoxygenase delta-13 isoform
• arachidonic 5-lipoxygenase delta-p10 isoform
• arachidonic acid 5-lipoxygenase
• EC 1.13.11
• EC 1.13.11.34
• leukotriene A4 synthase
• LOG5
• LOX5A
• MGC163204

Background

5 Lipoxygenase encodes a protein which, with Arachidonate 5-lipoxygenase-activating protein, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALOX5