5-HT7 Antibody - BSA Free

Immunohistochemistry: 5-HT7 Antibody [NBP2-68957] - Immunohistochemical staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

5-HT7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit 5-HT7 Antibody - BSA Free (NBP2-68957) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  5-HT7 Recombinant Protein Antigen (NBP2-68957PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 5-HT7 Antibody - BSA Free

• 5HT7
• 5-HT7
• 5-HT-7
• 5-HT75-hydroxytryptamine receptor 7
• 5-HT-X
• 5-hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled)
• HTR7
• serotonin 5-HT-7 receptor
• Serotonin receptor 7

Background

Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HTR1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). The 5-HT7 receptor (5-HT7R) is a seven-transmembrane-domain G-protein-coupled receptor that has important roles in regulating diverse biological process in the central and peripheral nervous systems (reviewed in Hedlund and Sutcliffe, 2004). Receptors for serotonin (5-hydroxytryptamine, 5-HT) are classified into seven major classes (5-HT1-7), based on structural, functional and pharmacological criteria (Hoyer et al, 1994). Sequence alignment shows a high degree of interspecies 5-HT7R homology (>90%), and a low homology with other 5-HTRs (

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR7