Home » 5-HT2B » 5-HT2B Antibodies » 5-HT2B Antibody

5-HT2B Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: 5-HT2B Antibody [NBP1-90322] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: 5-HT2B Antibody [NBP1-90322] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining in human endometrium and skeletal muscle tissues. Corresponding HTR2B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

5-HT2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Specificity
Specificity of human 5-HT2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
5-HT2B Protein (NBP1-90322PEP)
Publications
Read Publication using NBP1-90322.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23584090)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT2B Antibody

  • 5-HT(2B)
  • 5HT2B
  • 5-HT2B
  • 5-HT-2B
  • 5-HT2B5-HT 2B receptor
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • 5-hydroxytryptamine 2B receptor
  • 5-hydroxytryptamine receptor 2B
  • HTR2B
  • Serotonin receptor 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5-HT2A Antibody
NBP2-26091
Immunocytochemistry/Immunofluorescence: 5-HT2A Antibody [NBP2-26091] - Immunofluorescence analysis of paraformaldehyde fixed A549 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP2-26091] - Staining of paraffin embedded Human Cerebellum. Antibody at 2 ug/mL. Microwaved antigen retrieval with citrate buffer pH 6, HRP-staining.
Flow Cytometry: 5-HT2A Antibody [NBP2-26091] - Flow cytometric analysis of paraformaldehyde fixed A549 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
5-HT2C Antibody
(496214)
MAB5764
A172 human glioblastoma cell line was stained with Mouse Anti-Human 5HT2C Monoclonal Antibody (Catalog # MAB5764, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
5HT2C was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Mouse Anti-Human 5HT2C Monoclonal Antibody (Catalog # MAB5764) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: Flow, IHC, CyTOF-ready
5-HT1A Antibody
NBP2-21590
Western Blot: 5-HT1A Antibody [NBP2-21590] - Various tissue extracts (50 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with 5-HT1A receptor antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: 5-HT1A Antibody [NBP2-21590] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Frozen: 5-HT1A Antibody [NBP2-21590] - Frozen Sectioned adult mouse hippocampus. Green: 5-HT1A receptor protein stained by 5-HT1A receptor antibody [N3C1], Internal diluted at 1:250.Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
5-HT1B Antibody
NB100-56350
Western Blot: 5-HT1B Antibody [NB100-56350] - Analysis of 5-HT1B in human brain lysate with anti-5-HT1BR pcAb (NB100-56350). A protein band of approximate molecular weight of 40-41kDa was detected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
5-HT4 Antibody
NBP1-78403
Western Blot: 5-HT4 Antibody [NBP1-78403] - Western Blot Image of anti-5HT4 Receptor. Total protein from human liver tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-LYVE1 in 1% milk/TBST. Reactivity was detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: 5-HT4 Antibody [NBP1-78403] - Staining of 5HT4 receptor in HeLa cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Species: Hu
Applications: WB, ICC/IF
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
5-HT7 Antibody
NB100-56352
Western Blot: 5-HT7 Antibody [NB100-56352] - Analysis of 5-HT7R in A) human brain, B) mouse brain, C) rat brain, and D) human SK-N-SH neuroblastoma cell lysate using this antibody.
(16 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF
GDI1 Antibody
NBP2-99205
Western Blot: GDI1 Antibody [NBP2-99205] - Anti-GDI1 rabbit polyclonal antibody at 1:500 dilution. Lane A: NIHT3 Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti- Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 51 kDa. Observed band size: 47 kDa
Immunocytochemistry/Immunofluorescence: GDI1 Antibody [NBP2-99205] - Immunofluorescence staining of GDI1 in MCF7 cells. Cells were fixed with 4% PFA, permeabilzed with 0.3% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-human GDI1 polyclonal antibody (dilution ratio 1:1000) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green).Positive staining was localized to cytoplasm.
Immunohistochemistry-Paraffin: GDI1 Antibody [NBP2-99205] - Immunochemical staining of human GDI1 in human gastric cancer with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

SLC6A4/5-HTTLPR/Seroto ...
NB100-1892
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Human Colon lysate, 35 ug protein in RIPA buffer. Antibody at 2 ug/mL. Detection by chemiluminescence.
Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [NB100-1892] - Analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
5-HT6 Antibody
NBP1-46557
Immunohistochemistry: 5-HT6 Antibody [NBP1-46557] - LSM image showing strong expression of 5-HT6 (red) colocalized with virally transduced (green) TH (blue)-positive neurons within the dopaminergic fetal graft. Image collected and cropped by CiteAb from the following publication (linkinghub.elsevier.com/retrieve/pii/S0896627316300769), licensed under a CC-BY licence.
Immunohistochemistry: 5-HT6 Antibody [NBP1-46557] - The 5-HT6 Receptor Is highly expressed in human tissue grafts originating from both fetal and hESC. Immunofluorescence staining of 5-HT6 expression in a human dopaminergic fetal graft within the rat striatum with the phenotypic staining for TH, and the identification of human NCAM, imaged using LSM. Image collected and cropped by CiteAb from the following publication (linkinghub.elsevier.com/retrieve/pii/S0896627316300769), licensed under a CC-BY licence.
(2 Publications)
Species: Mu, Rt
Applications: WB, IHC
5-HT1D Antibody
NLS590
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Analysis of anti-5HT1D Receptor antibody with human spinal cord, dorsal root ganglion.
Immunohistochemistry-Paraffin: 5-HT1D Antibody [NLS590] - Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Hu, Pm
Applications: IHC, IHC-P
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Calreticulin
Antibody
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was conjugated with Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
(25 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
5-HT2B Antibody
NBP1-90322
5-HT2B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for 5-HT2B Antibody (NBP1-90322)(1)


Reviews for 5-HT2B Antibody (NBP1-90322) (0)

There are no reviews for 5-HT2B Antibody (NBP1-90322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 5-HT2B Antibody (NBP1-90322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional 5-HT2B Products

Bioinformatics Tool for 5-HT2B Antibody (NBP1-90322)

Discover related pathways, diseases and genes to 5-HT2B Antibody (NBP1-90322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2B Antibody (NBP1-90322)

Discover more about diseases related to 5-HT2B Antibody (NBP1-90322).
 

Pathways for 5-HT2B Antibody (NBP1-90322)

View related products by pathway.

PTMs for 5-HT2B Antibody (NBP1-90322)

Learn more about PTMs related to 5-HT2B Antibody (NBP1-90322).
 

Research Areas for 5-HT2B Antibody (NBP1-90322)

Find related products by research area.

Blogs on 5-HT2B

There are no specific blogs for 5-HT2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT2B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HTR2B