5-HT2B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: 5-HT2B Antibody [NBP1-90322] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: 5-HT2B Antibody [NBP1-90322] - Staining of human endometrium shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
5-HT2B Protein (NBP1-90322PEP)
Publications
Read Publication using NBP1-90322.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23584090)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT2B Antibody

  • 5-HT(2B)
  • 5HT2B
  • 5-HT2B
  • 5-HT-2B
  • 5-HT2B5-HT 2B receptor
  • 5-hydroxytryptamine (serotonin) receptor 2B
  • 5-hydroxytryptamine 2B receptor
  • 5-hydroxytryptamine receptor 2B
  • HTR2B
  • Serotonin receptor 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for 5-HT2B Antibody (NBP1-90322)(1)

Reviews for 5-HT2B Antibody (NBP1-90322) (0)

There are no reviews for 5-HT2B Antibody (NBP1-90322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 5-HT2B Antibody (NBP1-90322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT2B Products

Bioinformatics Tool for 5-HT2B Antibody (NBP1-90322)

Discover related pathways, diseases and genes to 5-HT2B Antibody (NBP1-90322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2B Antibody (NBP1-90322)

Discover more about diseases related to 5-HT2B Antibody (NBP1-90322).
 

Pathways for 5-HT2B Antibody (NBP1-90322)

View related products by pathway.

PTMs for 5-HT2B Antibody (NBP1-90322)

Learn more about PTMs related to 5-HT2B Antibody (NBP1-90322).
 

Research Areas for 5-HT2B Antibody (NBP1-90322)

Find related products by research area.

Blogs on 5-HT2B

There are no specific blogs for 5-HT2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2B
Entrez