5-HT5A Antibody (3D1) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR |
| Specificity |
HTR5A - 5-hydroxytryptamine (serotonin) receptor 5A (3D1) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HTR5A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for 5-HT5A Antibody (3D1) - Azide and BSA Free
Background
The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
Publications for 5-HT5A Antibody (H00003361-M02) (0)
There are no publications for 5-HT5A Antibody (H00003361-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT5A Antibody (H00003361-M02) (0)
There are no reviews for 5-HT5A Antibody (H00003361-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT5A Antibody (H00003361-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional 5-HT5A Products
Research Areas for 5-HT5A Antibody (H00003361-M02)
Find related products by research area.
|
Blogs on 5-HT5A