5-HT5A Antibody (10D3)


Sandwich ELISA: 5-HT5A Antibody (10D3) [H00003361-M01] - Detection limit for recombinant GST tagged HTR5A is approximately 0.03ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA

Order Details

5-HT5A Antibody (10D3) Summary

HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
HTR5A - 5-hydroxytryptamine (serotonin) receptor 5A
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5-HT5A Antibody (10D3)

  • 5HT5A
  • 5-HT5A
  • 5-HT-5A
  • 5-HT5A5-hydroxytryptamine receptor 5A
  • 5-hydroxytryptamine (serotonin) receptor 5A
  • HTR5A
  • MGC138226,5-HT-5
  • Serotonin receptor 5A


The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for 5-HT5A Antibody (H00003361-M01) (0)

There are no publications for 5-HT5A Antibody (H00003361-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT5A Antibody (H00003361-M01) (0)

There are no reviews for 5-HT5A Antibody (H00003361-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT5A Antibody (H00003361-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional 5-HT5A Products

Bioinformatics Tool for 5-HT5A Antibody (H00003361-M01)

Discover related pathways, diseases and genes to 5-HT5A Antibody (H00003361-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT5A Antibody (H00003361-M01)

Discover more about diseases related to 5-HT5A Antibody (H00003361-M01).

Pathways for 5-HT5A Antibody (H00003361-M01)

View related products by pathway.

Research Areas for 5-HT5A Antibody (H00003361-M01)

Find related products by research area.

Blogs on 5-HT5A

There are no specific blogs for 5-HT5A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 5-HT5A Antibody (10D3) and receive a gift card or discount.


Gene Symbol HTR5A