Recombinant Human 5-HT4 GST (N-Term) Protein Summary
Description |
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 388 of Human HTR4 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
HTR4 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Theoretical MW |
70.2 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human 5-HT4 GST (N-Term) Protein
Background
This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
Species: Hu
Applications: WB, Flow, CyTOF-ready
Publications for 5-HT4 Recombinant Protein (H00003360-P01) (0)
There are no publications for 5-HT4 Recombinant Protein (H00003360-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for 5-HT4 Recombinant Protein (H00003360-P01) (0)
There are no reviews for 5-HT4 Recombinant Protein (H00003360-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for 5-HT4 Recombinant Protein (H00003360-P01) (0)
Other Available Formats
Additional 5-HT4 Products
Bioinformatics Tool for 5-HT4 Recombinant Protein (H00003360-P01)
Discover related pathways, diseases and genes to 5-HT4 Recombinant Protein (H00003360-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for 5-HT4 Recombinant Protein (H00003360-P01)
Discover more about diseases related to 5-HT4 Recombinant Protein (H00003360-P01).
| | Pathways for 5-HT4 Recombinant Protein (H00003360-P01)
View related products by pathway.
|
PTMs for 5-HT4 Recombinant Protein (H00003360-P01)
Learn more about PTMs related to 5-HT4 Recombinant Protein (H00003360-P01).
| | Research Areas for 5-HT4 Recombinant Protein (H00003360-P01)
Find related products by research area.
|
Blogs on 5-HT4