Recombinant Human 5-HT4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 5-HT4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 388 of Human HTR4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HTR4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT4 Protein

  • 5HT4
  • 5-HT4
  • 5-HT-4
  • 5-HT4R
  • 5-hydroxytryptamine (serotonin) receptor 4,5-hydroxytryptamine receptor 4,5-HT45-hydroxytryptamine4 receptor
  • cardiac 5-HT4 receptor
  • HTR4
  • Serotonin receptor 4

Background

This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
AF2180
Species: Hu
Applications: WB, Simple Western, IP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-56349
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-52926
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003360-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no publications for 5-HT4 Recombinant Protein (H00003360-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no reviews for 5-HT4 Recombinant Protein (H00003360-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 5-HT4 Products

Bioinformatics Tool for 5-HT4 Recombinant Protein (H00003360-P01)

Discover related pathways, diseases and genes to 5-HT4 Recombinant Protein (H00003360-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT4 Recombinant Protein (H00003360-P01)

Discover more about diseases related to 5-HT4 Recombinant Protein (H00003360-P01).
 

Pathways for 5-HT4 Recombinant Protein (H00003360-P01)

View related products by pathway.

PTMs for 5-HT4 Recombinant Protein (H00003360-P01)

Learn more about PTMs related to 5-HT4 Recombinant Protein (H00003360-P01).
 

Research Areas for 5-HT4 Recombinant Protein (H00003360-P01)

Find related products by research area.

Blogs on 5-HT4

There are no specific blogs for 5-HT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

5-HT4 Antibody
NBP1-78403
5-HT7 Antibody
NB100-56352

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR4
Entrez