Recombinant Human 5-HT4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human 5-HT4 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 388 of Human HTR4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HTR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
70.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 5-HT4 GST (N-Term) Protein

  • 5HT4
  • 5-HT4
  • 5-HT-4
  • 5-HT4R
  • 5-hydroxytryptamine (serotonin) receptor 4,5-hydroxytryptamine receptor 4,5-HT45-hydroxytryptamine4 receptor
  • cardiac 5-HT4 receptor
  • HTR4
  • Serotonin receptor 4

Background

This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-90322
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NLS590
Species: Hu, Pm
Applications: IHC, IHC-P
H00002770-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no publications for 5-HT4 Recombinant Protein (H00003360-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no reviews for 5-HT4 Recombinant Protein (H00003360-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT4 Recombinant Protein (H00003360-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional 5-HT4 Products

Bioinformatics Tool for 5-HT4 Recombinant Protein (H00003360-P01)

Discover related pathways, diseases and genes to 5-HT4 Recombinant Protein (H00003360-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT4 Recombinant Protein (H00003360-P01)

Discover more about diseases related to 5-HT4 Recombinant Protein (H00003360-P01).
 

Pathways for 5-HT4 Recombinant Protein (H00003360-P01)

View related products by pathway.

PTMs for 5-HT4 Recombinant Protein (H00003360-P01)

Learn more about PTMs related to 5-HT4 Recombinant Protein (H00003360-P01).
 

Research Areas for 5-HT4 Recombinant Protein (H00003360-P01)

Find related products by research area.

Blogs on 5-HT4

There are no specific blogs for 5-HT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 5-HT4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR4