5-HT4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

5-HT4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HTR4.
  
  

  Source: E. coli

  Amino Acid Sequence: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HTR4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14109.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5-HT4 Recombinant Protein Antigen

• 5HT4
• 5-HT4
• 5-HT-4
• 5-HT4R
• 5-hydroxytryptamine (serotonin) receptor 4,5-hydroxytryptamine receptor 4,5-HT45-hydroxytryptamine4 receptor
• cardiac 5-HT4 receptor
• HTR4
• Serotonin receptor 4

Background

The 5-HT4 receptor, a member of the Serotonin Receptor subfamily, has been shown to affect the sensory and motor functions of the gut. Some of the most promising emerging therapies in Irritable Bowel Syndrome revolve around targeted pharmacotherapeutic modulation of serotonin receptors (ie, 5-HT3 and 5-HT4 subtypes). At least 9 isoforms (5-HT4A-5-HT4G, and 5-HT4n) have been described, which differ in the length and composition of their intracellular C termini after a common splicing site (L358). A ninth isoform (5-HT4H) results in the insertion of 14 amino acids into the second intracellular loop. 5-HT4 receptor expression has been documented primarily in the brain, and in colon, heart, and vessel. An EST has been isolated from a human cancerous nerve library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HTR4