4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

Images

 
There are currently no images for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 4-1BB/TNFRSF9/CD137.

Source: E. coli

Amino Acid Sequence: KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFRSF9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56432.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen

  • 4-1BB ligand receptor
  • 41BB
  • 4-1BB
  • CD137 antigen
  • CD137
  • CD137MGC2172
  • CDw137
  • FLJ43501
  • ILA
  • ILAhomolog of mouse 4-1BB
  • induced by lymphocyte activation (ILA)
  • interleukin-activated receptor, homolog of mouse Ly63
  • receptor protein 4-1BB
  • T cell antigen ILA
  • T-cell antigen 4-1BB homolog
  • T-cell antigen ILA
  • TNFRSF9
  • tumor necrosis factor receptor superfamily member 9
  • tumor necrosis factor receptor superfamily, member 9

Background

4-1BB, also called CD137 and tumor necrosis factor receptor superfamily member 9 (TNFRSF9), is a type I surface glycoprotein expressed on activated T cell and natural killer (NK) cells (1,2). Human 4-1BB protein is 255 amino acids (aa) in length with a theoretical molecular weight of 28 kDa. It contains an extracellular domain, a helical transmembrane domain, and a cytoplasmic/intracellular domain (3). 4-1BB/TNFRSF9/CD137 is a costimulatory receptor that binds the ligand 4-1BBL/CD137L which is primarily expressed on antigen presenting cells (APCs) such as dendritic cells (DCs), macrophages, and B cells (1,2,4,5). The 4-1BB receptor-ligand interaction results in recruitment of TNFR-associated factor (TRAF) family adaptor proteins to 4-1BB's cytoplasmic domain (1,2,4,5). TRAF1, TRAF2, and TRAF3 are found in various homodimer and/or heterodimer configurations. Their recruitment to 4-1BB/CD137 initiates signalosome formation as well as activation of the nuclear factor-kappa B (NF-kappaB) and mitogen-activated protein kinase (MAPK) signaling cascade (1,4,5). 4-1BB/TNFRSF9/CD137 stimulation leads to increased cellular cytotoxic activity and pro-inflammatory cytokine production (1,2,4). Given its role in immune cell activation, 4-1BB has become a promising target for cancer immunotherapy (1,2,4). Current approaches to target 4-1BB include agonistic monoclonal and bispecific anti-4-1BB antibodies and well as utilizing the cytoplasmic domain of 4-1BB in generating chimeric antigen receptors (CARs) (1,2,4). 4-1BB agonists in clinical trials include Urelumab and Utolimumab. Utolimumab also has ligand blocking properties whereas Urelumab does not (1,2,4). Anti-4-1BB monoclonal antibodies are being tested as monotherapy as well as combination therapy with either other immunostimulatory monoclonal antibodies or with checkpoint blockade antibodies like anti-PD-1 (1,2,4).

References

1. Etxeberria, I., Glez-Vaz, J., Teijeira, A., & Melero, I. (2020). New emerging targets in cancer immunotherapy: CD137/4-1BB costimulatory axis. ESMO open, 4(Suppl 3), e000733. https://doi.org/10.1136/esmoopen-2020-000733

2. Chester, C., Sanmamed, M. F., Wang, J., & Melero, I. (2018). Immunotherapy targeting 4-1BB: mechanistic rationale, clinical results, and future strategies. Blood, 131(1), 49-57. https://doi.org/10.1182/blood-2017-06-741041

3. Uniport (Q07011)

4. Chester, C., Ambulkar, S., & Kohrt, H. E. (2016). 4-1BB agonism: adding the accelerator to cancer immunotherapy. Cancer Immunology, Immunotherapy: CII, 65(10), 1243-1248. https://doi.org/10.1007/s00262-016-1829-2

5. Zapata, J. M., Perez-Chacon, G., Carr-Baena, P., Martinez-Forero, I., Azpilikueta, A., Otano, I., & Melero, I. (2018). CD137 (4-1BB) signalosome: complexity is a matter of TRAFs. Frontiers in Immunology, 9, 2618. https://doi.org/10.3389/fimmu.2018.02618

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1246
Species: Mu
Applications: WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
202-IL
Species: Hu
Applications: BA
AF3388
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
485-MI
Species: Mu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
DCDL40
Species: Hu
Applications: ELISA
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
AF382
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB

Publications for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP) (0)

There are no publications for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP) (0)

There are no reviews for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 4-1BB/TNFRSF9/CD137 Products

Research Areas for 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen (NBP2-56432PEP)

Find related products by research area.

Blogs on 4-1BB/TNFRSF9/CD137

There are no specific blogs for 4-1BB/TNFRSF9/CD137, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 4-1BB/TNFRSF9/CD137 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF9