12-Lipoxygenase Antibody

Images

 
Western Blot: 12-Lipoxygenase Antibody [NBP1-90338] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody [NBP1-90338] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody [NBP1-90338] - Staining of human heart muscle shows distinct positivity in myocytes.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody [NBP1-90338] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody [NBP1-90338] - Staining of human pancreas shows weak membranous and cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: 12-Lipoxygenase Antibody [NBP1-90338] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

12-Lipoxygenase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALOX12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
12-Lipoxygenase Protein (NBP1-90338PEP)
Publications
Read Publication using
NBP1-90338 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 12-Lipoxygenase Antibody

  • 12(S)-lipoxygenase
  • 12-Lipoxygenase
  • 12LO
  • 12-LOX
  • 12S-lipoxygenase
  • 12S-LOX
  • 12S-LOXarachidonate 12-lipoxygenase, 12S-type
  • ALOX12
  • arachidonate 12-lipoxygenase
  • EC 1.13.11
  • EC 1.13.11.-
  • EC 1.13.11.31
  • EC 1.13.11.33
  • EC 3.3.2.-
  • LOG12
  • platelet 12-LOX
  • platelet-type 12-lipoxygenase
  • Platelet-type lipoxygenase 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01740
Species: Ca, Hu, Pm, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
H00001351-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32550
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
236-EG
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-92668
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-90338
Species: Hu
Applications: WB, IHC, IHC-P

Publications for 12-Lipoxygenase Antibody (NBP1-90338)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for 12-Lipoxygenase Antibody (NBP1-90338) (0)

There are no reviews for 12-Lipoxygenase Antibody (NBP1-90338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 12-Lipoxygenase Antibody (NBP1-90338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 12-Lipoxygenase Products

Bioinformatics Tool for 12-Lipoxygenase Antibody (NBP1-90338)

Discover related pathways, diseases and genes to 12-Lipoxygenase Antibody (NBP1-90338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 12-Lipoxygenase Antibody (NBP1-90338)

Discover more about diseases related to 12-Lipoxygenase Antibody (NBP1-90338).
 

Pathways for 12-Lipoxygenase Antibody (NBP1-90338)

View related products by pathway.

PTMs for 12-Lipoxygenase Antibody (NBP1-90338)

Learn more about PTMs related to 12-Lipoxygenase Antibody (NBP1-90338).
 

Research Areas for 12-Lipoxygenase Antibody (NBP1-90338)

Find related products by research area.

Blogs on 12-Lipoxygenase

There are no specific blogs for 12-Lipoxygenase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 12-Lipoxygenase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12