ALOX12B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALOX12B Antibody [NBP1-89409] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry: ALOX12B Antibody [NBP1-89409] - Analysis of ALOX12B and PTGIS proteins expression in tumor and non-tumor tissue by Immunohistochemistry. Expression of ALOX12B protein; the arrows show weak labeling ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALOX12B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Specificity
Specificity of human ALOX12B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALOX12B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALOX12B Protein (NBP1-89409PEP)
Publications
Read Publication using
NBP1-89409 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALOX12B Antibody

  • 12R-LOXEC 1.13.11.-
  • arachidonate 12-lipoxygenase, 12R type
  • arachidonate 12-lipoxygenase, 12R-type
  • EC 1.13.11.33,12R-lipoxygenase
  • Epidermis-type lipoxygenase 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46512
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32533
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-58984
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-01740
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-93466
Species: Hu, Mu, Ca
Applications: IB, ICC/IF, IP, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P

Publications for ALOX12B Antibody (NBP1-89409)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ALOX12B Antibody (NBP1-89409) (0)

There are no reviews for ALOX12B Antibody (NBP1-89409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALOX12B Antibody (NBP1-89409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ALOX12B Products

Bioinformatics Tool for ALOX12B Antibody (NBP1-89409)

Discover related pathways, diseases and genes to ALOX12B Antibody (NBP1-89409). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALOX12B Antibody (NBP1-89409)

Discover more about diseases related to ALOX12B Antibody (NBP1-89409).
 

Pathways for ALOX12B Antibody (NBP1-89409)

View related products by pathway.

PTMs for ALOX12B Antibody (NBP1-89409)

Learn more about PTMs related to ALOX12B Antibody (NBP1-89409).
 

Research Areas for ALOX12B Antibody (NBP1-89409)

Find related products by research area.

Blogs on ALOX12B

There are no specific blogs for ALOX12B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALOX12B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12B