ALOX12B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALOX12B Antibody [NBP1-89409] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry: ALOX12B Antibody [NBP1-89409] - Analysis of ALOX12B and PTGIS proteins expression in tumor and non-tumor tissue by Immunohistochemistry. Expression of ALOX12B protein; the arrows show weak labeling ...read more
Analysis of ALOX12B and PTGIS proteins expression in tumor and non-tumor tissue by Immunohistochemistry. I: Expression of ALOX12B protein; the arrows show weak labeling (brown staining) of non-tumor squamous cells in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALOX12B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALOX12B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALOX12B Protein (NBP1-89409PEP)
Publications
Read Publications using
NBP1-89409 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALOX12B Antibody

  • 12R-LOXEC 1.13.11.-
  • arachidonate 12-lipoxygenase, 12R type
  • arachidonate 12-lipoxygenase, 12R-type
  • EC 1.13.11.33,12R-lipoxygenase
  • Epidermis-type lipoxygenase 12

Background

ALOX12B, or Arachidonate 12-lipoxygenase, 12R-type has a 701 amino acid isoform that is 80 kDa, and is involved in the transformation of arachidonic acid into 12R-hydroxyeicosatetraenoic acid. Current research is being studied on the relation between ALOX12B and a variety of diseases and disorders including epithelial ovarian cancer, meningioma, breast cancer, leukemia, tonsillitis, ichthyosis, anhidrosis, autosomal recessive congenital ichthyosis, and dermatitis. This protein interacts with LMNA, KRT5, ALOX12, ALOX15, and ALOX15B in arachidonic acid metabolism, 112-eicosatetraenoic acid derivative synthesis, and lipid and lipoprotein metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALOX12B Antibody (NBP1-89409)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IF/IHC, IHC.


Filter By Application
IF/IHC
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ALOX12B Antibody (NBP1-89409) (0)

There are no reviews for ALOX12B Antibody (NBP1-89409). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALOX12B Antibody (NBP1-89409) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALOX12B Products

Research Areas for ALOX12B Antibody (NBP1-89409)

Find related products by research area.

Blogs on ALOX12B

There are no specific blogs for ALOX12B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALOX12B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOX12B