ZSCAN1 Antibody - Azide and BSA Free

Western Blot: ZSCAN1 Antibody - Azide and BSA Free [ZSCAN1] - Western blot analysis of lysates from T-47D cells, using ZSCAN1 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 30s.

Western Blot: ZSCAN1 Antibody - Azide and BSA Free [ZSCAN1] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZSCAN1 using ZSCAN1 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZSCAN1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ZSCAN1 (NP_872378.3). VFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZSCAN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for ZSCAN1 Antibody - Azide and BSA Free

• FLJ33779
• MGC104472
• MZF-1
• zinc finger and SCAN domain containing 1
• zinc finger and SCAN domain-containing protein 1
• zinc finger with SCAN domain 1
• ZNF915

Background

"ZSCAN1 may be involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ZSCAN1