ZRANB1/Trabid Antibody

Images

 
Immunohistochemistry: ZRANB1/Trabid Antibody [NBP1-86917] - Staining of human corpus, uterine shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZRANB1/Trabid Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZRANB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZRANB1/Trabid Protein (NBP1-86917PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZRANB1/Trabid Antibody

  • HRPE773
  • jacalin-like lectin domain containing 2
  • JCLN2
  • pancreatic adenocarcinoma upregulated factor
  • PAUF
  • PRO1567
  • Trabid
  • ZRANB1
  • zymogen granule protein 16 homolog B (rat)
  • zymogen granule protein 16 homolog B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8408
Species: Hu
Applications: WB
NBP1-88095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
H00078990-D01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP2-45715
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, IHC, IF
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86917
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ZRANB1/Trabid Antibody (NBP1-86917) (0)

There are no publications for ZRANB1/Trabid Antibody (NBP1-86917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZRANB1/Trabid Antibody (NBP1-86917) (0)

There are no reviews for ZRANB1/Trabid Antibody (NBP1-86917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZRANB1/Trabid Antibody (NBP1-86917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZRANB1/Trabid Products

Bioinformatics Tool for ZRANB1/Trabid Antibody (NBP1-86917)

Discover related pathways, diseases and genes to ZRANB1/Trabid Antibody (NBP1-86917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZRANB1/Trabid Antibody (NBP1-86917)

Discover more about diseases related to ZRANB1/Trabid Antibody (NBP1-86917).
 

Pathways for ZRANB1/Trabid Antibody (NBP1-86917)

View related products by pathway.

Research Areas for ZRANB1/Trabid Antibody (NBP1-86917)

Find related products by research area.

Blogs on ZRANB1/Trabid

There are no specific blogs for ZRANB1/Trabid, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZRANB1/Trabid Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZRANB1
Entrez