ZNHIT1 Antibody

Images

 
Western Blot: ZNHIT1 Antibody [NBP1-79374] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNHIT1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNHIT1The immunogen for this antibody is ZNHIT1. Peptide sequence MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNHIT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNHIT1 and was validated on Western blot.
Control
ZNHIT1 Lysate (NBP2-65845)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNHIT1 Antibody

  • CG1I
  • CGBP1
  • Cyclin-G1-binding protein 1
  • H_DJ0747G18.14
  • p18 Hamlet
  • p18Hamlet
  • putative cyclin G1 interacting protein
  • zinc finger HIT domain-containing protein 1
  • Zinc finger protein subfamily 4A member 1
  • zinc finger protein, subfamily 4A (HIT domain containing), member 1
  • zinc finger, HIT domain containing 1
  • zinc finger, HIT type 1
  • zinc finger, HIT-type containing 1
  • ZNFN4A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45244
Species: Hu, Mu, Rt, Ca
Applications: PEP-ELISA
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-71689
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-812
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89186
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3809
Species: Hu, Mu
Applications: WB
NBP1-88430
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65725
Species: Hu
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, ICC/IF, IF
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-79374
Species: Hu
Applications: WB

Publications for ZNHIT1 Antibody (NBP1-79374) (0)

There are no publications for ZNHIT1 Antibody (NBP1-79374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNHIT1 Antibody (NBP1-79374) (0)

There are no reviews for ZNHIT1 Antibody (NBP1-79374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNHIT1 Antibody (NBP1-79374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNHIT1 Antibody (NBP1-79374)

Discover related pathways, diseases and genes to ZNHIT1 Antibody (NBP1-79374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNHIT1 Antibody (NBP1-79374)

Discover more about diseases related to ZNHIT1 Antibody (NBP1-79374).
 

Pathways for ZNHIT1 Antibody (NBP1-79374)

View related products by pathway.

PTMs for ZNHIT1 Antibody (NBP1-79374)

Learn more about PTMs related to ZNHIT1 Antibody (NBP1-79374).

Blogs on ZNHIT1

There are no specific blogs for ZNHIT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNHIT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNHIT1
Uniprot