ZNFN1A4 Antibody


Western Blot: ZNFN1A4 Antibody [NBP2-55305] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: ZNFN1A4 Antibody [NBP2-55305] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

ZNFN1A4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGA
Specificity of human IKZF4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IKZF4 Recombinant Protein Antigen (NBP2-55305PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZNFN1A4 Antibody

  • EOS
  • IKAROS family zinc finger 4 (Eos)
  • Ikaros family zinc finger protein 4
  • KIAA1782Eos
  • zinc finger protein, subfamily 1A, 4 (Eos)
  • zinc finger transcription factor Eos
  • ZNFN1A4zinc finger protein Eos


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Mu
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ZNFN1A4 Antibody (NBP2-55305) (0)

There are no publications for ZNFN1A4 Antibody (NBP2-55305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNFN1A4 Antibody (NBP2-55305) (0)

There are no reviews for ZNFN1A4 Antibody (NBP2-55305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNFN1A4 Antibody (NBP2-55305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNFN1A4 Antibody (NBP2-55305)

Discover related pathways, diseases and genes to ZNFN1A4 Antibody (NBP2-55305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNFN1A4 Antibody (NBP2-55305)

Discover more about diseases related to ZNFN1A4 Antibody (NBP2-55305).

Pathways for ZNFN1A4 Antibody (NBP2-55305)

View related products by pathway.

Blogs on ZNFN1A4

There are no specific blogs for ZNFN1A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNFN1A4 Antibody and receive a gift card or discount.


Gene Symbol IKZF4