ZNFN1A4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ZNFN1A4 Antibody [NBP2-14120] Staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNFN1A4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNFN1A4 Antibody - BSA Free (NBP2-14120) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IKZF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZNFN1A4 Protein (NBP2-14120PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNFN1A4 Antibody - BSA Free

• EOS
• IKAROS family zinc finger 4 (Eos)
• Ikaros family zinc finger protein 4
• KIAA1782Eos
• zinc finger protein, subfamily 1A, 4 (Eos)
• zinc finger transcription factor Eos
• ZNFN1A4zinc finger protein Eos

Background

Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IKZF4