ZNF823 Antibody

Images

 
Western Blot: ZNF823 Antibody [NBP2-84366] - WB Suggested Anti-HSZFP36 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Liver

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF823 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF823. Peptide sequence: GKAFSLAGSLRRHEATHTGVKPYKCQCGKAFSDLSSFQNHETTHTGEKPY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF823
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF823 Antibody

  • HSZFP36
  • ZFP 36 for a zinc finger protein
  • ZFP-36 for a zinc finger protein
  • ZFP36
  • zinc finger protein 823
  • zinc finger protein ZFP-36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
AF4245
Species: Hu
Applications: WB, IP
NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-83654
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-00764
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-84366
Species: Hu
Applications: WB

Publications for ZNF823 Antibody (NBP2-84366) (0)

There are no publications for ZNF823 Antibody (NBP2-84366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF823 Antibody (NBP2-84366) (0)

There are no reviews for ZNF823 Antibody (NBP2-84366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF823 Antibody (NBP2-84366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF823 Products

Array NBP2-84366

Bioinformatics Tool for ZNF823 Antibody (NBP2-84366)

Discover related pathways, diseases and genes to ZNF823 Antibody (NBP2-84366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF823

There are no specific blogs for ZNF823, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF823 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF823