ZNF81 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF81 Antibody [NBP2-13598] - Staining of human colon shows strong cytoplasmic positivity in glandular cells, ganglion cells were moderately stained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF81 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQ VFTQNSSYSHHENTHTGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANT CT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF81
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF81 Protein (NBP2-13598PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF81 Antibody

  • dJ54B20.6
  • FLJ44367
  • HFZ20X-linked 45
  • zinc finger protein 81 (HFZ20)
  • zinc finger protein 81

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13412
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ZNF81 Antibody (NBP2-13598) (0)

There are no publications for ZNF81 Antibody (NBP2-13598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF81 Antibody (NBP2-13598) (0)

There are no reviews for ZNF81 Antibody (NBP2-13598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF81 Antibody (NBP2-13598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF81 Products

Bioinformatics Tool for ZNF81 Antibody (NBP2-13598)

Discover related pathways, diseases and genes to ZNF81 Antibody (NBP2-13598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF81 Antibody (NBP2-13598)

Discover more about diseases related to ZNF81 Antibody (NBP2-13598).
 

Pathways for ZNF81 Antibody (NBP2-13598)

View related products by pathway.

Blogs on ZNF81

There are no specific blogs for ZNF81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF81 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF81