ZNF608 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF608 Antibody [NBP1-85109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF608 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPGTPKGKRELMSNGPGSIIGAKAGKNSGKKKGLNNELNNLPVISNMTAALDSCSAADGSLAAEMPKLEAEGLIDKKNLGDKEKGKKATNCKTDKNLSKLKSARPIAPAPAPTPPQLIAIPTATFTTTTTGTIPGLPSLTTTVVQATP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF608
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 27166999).
Control Peptide
ZNF608 Protein (NBP1-85109PEP)
Publications
Read Publication using
NBP1-85109 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF608 Antibody

  • DKFZp434M098
  • DKFZp781C0723
  • KIAA1281
  • MGC166851
  • NY-REN-36
  • Renal carcinoma antigen NY-REN-36
  • zinc finger protein 608

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
AF6379
Species: Hu
Applications: WB
AF5394
Species: Hu, Mu
Applications: WB
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-30449
Species: Hu
Applications: IHC, IHC-P
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20758
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC
H00054814-B01P
Species: Hu
Applications: WB, ELISA
NBP1-86772
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF608 Antibody (NBP1-85109)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ZNF608 Antibody (NBP1-85109) (0)

There are no reviews for ZNF608 Antibody (NBP1-85109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF608 Antibody (NBP1-85109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF608 Products

Bioinformatics Tool for ZNF608 Antibody (NBP1-85109)

Discover related pathways, diseases and genes to ZNF608 Antibody (NBP1-85109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF608 Antibody (NBP1-85109)

Discover more about diseases related to ZNF608 Antibody (NBP1-85109).
 

Pathways for ZNF608 Antibody (NBP1-85109)

View related products by pathway.

Blogs on ZNF608

There are no specific blogs for ZNF608, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF608 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF608