![Immunocytochemistry/Immunofluorescence: ZNF608 Antibody [NBP1-85109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/ZNF608-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85109-img0004.jpg "Immunocytochemistry/Immunofluorescence: ZNF608 Antibody [NBP1-85109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ZNF608 Antibody - BSA Free (NBP1-85109) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ZNF608 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPGTPKGKRELMSNGPGSIIGAKAGKNSGKKKGLNNELNNLPVISNMTAALDSCSAADGSLAAEMPKLEAEGLIDKKNLGDKEKGKKATNCKTDKNLSKLKSARPIAPAPAPTPPQLIAIPTATFTTTTTGTIPGLPSLTTTVVQATP |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF608 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-85109 | Applications | Species |
|---|---|---|
| Baez-Vega PM, Echevarria Vargas IM, Valiyeva F et al. Targeting miR-21-3p inhibits proliferation and invasion of ovarian cancer cells. Oncotarget. 2016-06-14 [PMID: 27166999] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF608 |
![Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.](http://images.novusbio.com/fullsize/ZNF608-Antibody-Immunohistochemistry-Paraffin-NBP1-85109-img0008.jpg "Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ZNF608-Antibody-Immunohistochemistry-Paraffin-NBP1-85109-img0006.jpg "Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/ZNF608-Antibody-Immunohistochemistry-Paraffin-NBP1-85109-img0007.jpg "Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.](http://images.novusbio.com/fullsize/ZNF608-Antibody-Immunohistochemistry-Paraffin-NBP1-85109-img0009.jpg "Immunohistochemistry-Paraffin: ZNF608 Antibody [NBP1-85109] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.")
![Neutralization M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images2/M-CSF_R_MAB3291_Block_Neutralize_2359.jpg)
![Western Blot M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images2/M-CSF_R_MAB3291_Western_Blot_7396.jpg)
![Immunohistochemistry M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3291_human-m-csf-r-cd115-mab-clone-61701-immunohistochemistry-10102023145649..jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunohistochemistry Neurexin 3/NRXN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5269_human-mouse-neurexin-3-affinity-purified-polyclonal-ab-immunohistochemistry-2682022134435.jpg)
![Western Blot Neurexin 3/NRXN3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5269_human-mouse-neurexin-3-affinity-purified-polyclonal-ab-western-blot-612023112046.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")