ZNF592 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSPSVAASS |
| Predicted Species |
Mouse (95%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZNF592 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ZNF592 Antibody - BSA Free
Background
ZNF592 is a zinc-finger protein that belongs to the krueppel C2H2-type zinc-finger family of proteins. ZNF592 bears 13 C2H2-type zinc-fingers and is hypothesized to function as a transcriptional regulator.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Publications for ZNF592 Antibody (NBP1-86647) (0)
There are no publications for ZNF592 Antibody (NBP1-86647).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF592 Antibody (NBP1-86647) (0)
There are no reviews for ZNF592 Antibody (NBP1-86647).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF592 Antibody (NBP1-86647) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF592 Products
Blogs on ZNF592