CSMD2 Antibody

Images

 
Immunohistochemistry-Paraffin: CSMD2 Antibody [NBP1-93569] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSMD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSMD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CSMD2 Protein (NBP1-93569PEP)
Publications
Read Publications using
NBP1-93569 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (Gutierrez M et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSMD2 Antibody

  • CUB and sushi domain-containing protein 2
  • CUB and Sushi multiple domains 2
  • dJ1007G16.1
  • dJ947L8.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29341
Species: Hu
Applications: PEP-ELISA, WB
MAB2607
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-91993
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31138
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86371
Species: Hu
Applications: IHC, IHC-P
NBP2-58807
Species: Hu
Applications: ICC/IF, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB4449
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP3-17507
Species: Hu
Applications: ICC/IF, WB
NBP1-90836
Species: Hu
Applications: IHC, IHC-P
NBP2-92130
Species: Hu, Mu, Rt
Applications: WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81857
Species: Hu
Applications: IHC, IHC-P, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-86308
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33197
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for CSMD2 Antibody (NBP1-93569)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(2)
IHC
(2)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-93569 Applications Species
Csmd2 is a Synaptic Transmembrane Protein that Interacts with PSD-95. Gutierrez M, Dwyer B, Franco S eNeuro [PMID: 31068362] (IHC, ICC/IF, WB, Mouse) IHC, ICC/IF, WB Mouse
Gutierrez MA Novel requirements of the synaptic transmembrane protein Csmd2 in neuronal maturation and structural plasticity Thesis Jan 1 2020 (WB, IHC, ICC/IF, Mouse, Human) WB, IHC, ICC/IF Mouse, Human

Reviews for CSMD2 Antibody (NBP1-93569) (0)

There are no reviews for CSMD2 Antibody (NBP1-93569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CSMD2 Antibody (NBP1-93569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSMD2 Products

Array NBP1-93569

Bioinformatics Tool for CSMD2 Antibody (NBP1-93569)

Discover related pathways, diseases and genes to CSMD2 Antibody (NBP1-93569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSMD2 Antibody (NBP1-93569)

Discover more about diseases related to CSMD2 Antibody (NBP1-93569).
 

Pathways for CSMD2 Antibody (NBP1-93569)

View related products by pathway.

PTMs for CSMD2 Antibody (NBP1-93569)

Learn more about PTMs related to CSMD2 Antibody (NBP1-93569).
 

Research Areas for CSMD2 Antibody (NBP1-93569)

Find related products by research area.

Blogs on CSMD2

There are no specific blogs for CSMD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSMD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSMD2