CSMD2 Antibody

Images

 
Immunohistochemistry-Paraffin: CSMD2 Antibody [NBP1-93569] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSMD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Specificity
Specificity of human CSMD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSMD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-93569 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSMD2 Antibody

  • CUB and sushi domain-containing protein 2
  • CUB and Sushi multiple domains 2
  • dJ1007G16.1
  • dJ947L8.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29341
Species: Hu
Applications: WB, PEP-ELISA
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-22439
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-91993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85326
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86371
Species: Hu
Applications: IHC, IHC-P
NBP2-58807
Species: Hu
Applications: WB, ICC/IF
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4449
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-04656
Species: Hu
NBP1-90836
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58206
Species: Hu
Applications: ICC/IF
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-81857
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58768
Species: Hu
Applications: ICC/IF
NBP1-86308
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33197
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CSMD2 Antibody (NBP1-93569)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-93569 Applications Species
Gutierrez M, Dwyer B, Franco S. Csmd2 is a Synaptic Transmembrane Protein that Interacts with PSD-95. bioRxiv Jul 5 2018 (WB, IHC, Mouse) WB, IHC Mouse

Reviews for CSMD2 Antibody (NBP1-93569) (0)

There are no reviews for CSMD2 Antibody (NBP1-93569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CSMD2 Antibody (NBP1-93569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CSMD2 Products

Array NBP1-93569

Bioinformatics Tool for CSMD2 Antibody (NBP1-93569)

Discover related pathways, diseases and genes to CSMD2 Antibody (NBP1-93569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSMD2 Antibody (NBP1-93569)

Discover more about diseases related to CSMD2 Antibody (NBP1-93569).
 

Pathways for CSMD2 Antibody (NBP1-93569)

View related products by pathway.

PTMs for CSMD2 Antibody (NBP1-93569)

Learn more about PTMs related to CSMD2 Antibody (NBP1-93569).

Blogs on CSMD2

There are no specific blogs for CSMD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSMD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSMD2